PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2271_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MIKC_MADS
Protein Properties Length: 161aa    MW: 18049.7 Da    PI: 8.0832
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2271_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.32.8e-25958150
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  RrC2271_p1  9 KRIENVNNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                79*********************************************997 PP

2K-box62.71.5e-2171135165
       K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkki 65 
                 yqk sgk+l++ak+e+l++e++ +kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+ +e++l k+
  RrC2271_p1  71 YQKLSGKKLWDAKHENLNNEIDMIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHGVEHGLDKV 135
                 899***********************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.151161IPR002100Transcription factor, MADS-box
CDDcd002652.17E-38280No hitNo description
SuperFamilySSF554551.44E-33296IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.0E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-1282136IPR002487Transcription factor, K-box
PROSITE profilePS512978.9884161IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MGRGKIEIKR IENVNNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLNNE IDMIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHGVEH GLDKVHGVPY DKEEKRENDG GGESAAQFPA G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A5e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D5e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P5e-16163163Myocyte-specific enhancer factor 2B
1tqe_Q5e-16163163Myocyte-specific enhancer factor 2B
1tqe_R5e-16163163Myocyte-specific enhancer factor 2B
1tqe_S5e-16163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679630.0KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013667321.19e-93PREDICTED: floral homeotic protein PISTILLATA-like
SwissprotP480074e-92PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA8V3498e-98A8V349_BRANA; PISTILLATA-3
STRINGBra002285.1-P3e-91(Brassica rapa)
STRINGBra020093.1-P2e-90(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-93MIKC_MADS family protein